The store will not work correctly when cookies are disabled.
Solubility & Handling
|
Storage instructions
|
-20°C |
|
Solubility overview
|
Soluble in 1.0% NH4OH |
|
Handling
|
Please note that this product is supplied as a lyophilized solid and may be very hard to visualize.
Amyloid beta peptides are prone to aggregation and as such, there are a variety of published methods for handling amyloid beta peptides.
We recommend using NH4OH with this product - you should use 1.0% NH4OH as the solvent followed by buffer (for example 1X PBS).
- Add 1.0% NH4OH directly to the lyophilized peptide (~70-80 μl for 1mg of peptide). Do not store the peptide in 1.0% NH4OH.
- Immediately dilute your solution to a concentration of ~1mg/mL or less with 1X PBS or alternative buffer.
- Vortex gently to mix (less than 1 minute).
Note: This method may not completely remove pre-aggregates. Vortexing may encourage seeding and further aggregation of the peptide. |
|
Important
|
This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. Not for human or veterinary use |
Chemical Data
|
Chemical name
|
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
|
Chemical structure
|
|
|
Molecular Formula
|
C203H311N55O60S |
|
Sequence (one letter)
|
AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
|
PubChem identifier
|
71581486 |
|
SMILES
|
CCC(C)[C@@H](C(=O)N[C@@H](C(C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@H](C(C)C)C(=O)N[C@H](CC(=O)O)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](C)C(=O)N[C@H](CC1=CC=CC=C1)C(=O)N[C@H](CC2=CC=CC=C2)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N[C@H](CCC(=O)N)C(=O)N[C@H](CC3=CNC=N3)C(=O)N[C@H](CC4=CNC=N4)C(=O)N[C@H](C(C)C)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](CC5=CC=C(C=C5)O)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](CC(=O)O)C(=O)N[C@H](CC6=CNC=N6)C(=O)N[C@H](CCCNC(=N)N)C(=O)N[C@H](CC7=CC=CC=C7)C(=O)N[C@H](CCC(=O)O)C(=O)N[C@H](C)C(=O)N[C@H](CC(=O)O)C(=O)O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)CNC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)CC)NC(=O)[C@H](C)N |
|
InChiKey
|
QBEAMNLSDYIUGM-TYMWQTOHSA-N |
|
Appearance
|
Lyophilized White solid |
References for β-Amyloid Peptide (42-1) (human)
References are publications that support the biological activity of the product
-
Amyloidogenicity and toxicity of the reverse and scrambled variants of amyloid-β 1-42.
Vadukul et al (2017)
FEBS Lett. 591(5) : 822-830
β-Amyloid Peptide (1-42) inactive control.